DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk1b1

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:242 Identity:74/242 - (30%)
Similarity:117/242 - (48%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVD 101
            ::.|.:.|.:|.|:.|::   |....:||||.|::.:|::|||||..|.  .::..|.:...:.:
Mouse    25 IVGGFKCEKNSQPWHVAV---YRYKEYICGGVLLDANWVLTAAHCYYEK--NNVWLGKNNLYQDE 84

  Fly   102 ELTQQRQVDFGRVHEKYTGGV------GP-----YDIALLHVNESFIFNEWVQPATLPSREQVHE 155
            ...|.|.|....:|..|...:      .|     ||:.||.:::.....:.|:|..||: |:...
Mouse    85 PSAQHRLVSKSFLHPCYNMSLHRNRIQNPQDDYSYDLMLLRLSKPADITDVVKPIALPT-EEPKL 148

  Fly   156 GETHL-YGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNG 219
            |.|.| .|||......|..||.||.|..::|..|:|.:...:.  :.:..:|:......|..|.|
Mouse   149 GSTCLASGWGSIIPVKFQYAKDLQCVNLKLLPNEDCDKAYVQK--VTDVMLCAGVKGGGKDTCKG 211

  Fly   220 DSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            ||||||:.:     ..|.|:.||||.|||....|.:|||:..:..||
Mouse   212 DSGGPLICD-----GVLQGLTSWGYNPCGEPKKPGVYTKLIKFTSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 74/242 (31%)
Tryp_SPc 37..266 CDD:214473 72/240 (30%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.