DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk1b21

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011249110.1 Gene:Klk1b21 / 16616 MGIID:892022 Length:296 Species:Mus musculus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:121/274 - (44%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGM-SIIAGLHTRAEV 100
            ::.|...|.:|.|:.|::   :..:.:||||.|:|.:|::|||||....... ::..|.:...:.
Mouse    25 IVGGFNCEKNSQPWHVAV---FRYNKYICGGVLLNPNWVLTAAHCYGNATSQYNVWLGKNKLFQH 86

  Fly   101 DELTQQRQVDFGRVHEKYTGGV----GPY-------DIALLHVNESFIFNEWVQPATLPSREQVH 154
            :...|.|.|.....|..|...:    .|:       |:.||.:::.....:.|:|..||: |:..
Mouse    87 ESSAQHRLVSKSFPHPDYNMSLMNDHTPHPEDDYSNDLMLLRLSKPADITDAVKPIDLPT-EEPK 150

  Fly   155 EGETHL-YGWGQ---------PKSY--IFSGAK-----------TLQTVTTQILNYEECK--EEL 194
            .|.|.| .|||.         |::.  ...||:           :|.: |.||.|..:|.  :.|
Mouse   151 LGSTCLASGWGSITPTKCESAPRNIARCRGGAEGPGLGPVHHPLSLSS-TGQIPNDLQCGFIKPL 214

  Fly   195 PES-------APIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANM 252
            |..       ..:.:..:|:..:...|..|.|||||||:.:     ..|.||.|||.|||...|.
Mouse   215 PNENCAKAYIHKVTDVMLCAGEMGGGKDTCAGDSGGPLICD-----GVLQGITSWGSIPCAKPNA 274

  Fly   253 PSIYTKVSAYIDWI 266
            |:||||:..:..||
Mouse   275 PAIYTKLIKFTSWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 76/274 (28%)
Tryp_SPc 37..266 CDD:214473 74/272 (27%)
Klk1b21XP_011249110.1 Tryp_SPc 25..291 CDD:238113 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.