DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Klk5

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:292 Identity:79/292 - (27%)
Similarity:121/292 - (41%) Gaps:41/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLITVTLVIALVAAAQGAKLSDKLAKLVPSFAT------------------------GFVINGTE 42
            |....||:..||.......|:|.:|....|..|                        ..::||::
  Rat     9 KWAMATLIATLVLGVSELALADDVASCDNSSGTKPSGTNRDLNTDSNSGEDTRSDSSSRIVNGSD 73

  Fly    43 AEPHSAPY--IVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQ 105
            ....:.|:  .:.|..|.|    .||..|||..|::||||| .:|| ..|..|.|:.:.|.|..|
  Rat    74 CPKDTQPWQGALLLGPNKL----YCGAVLINPQWLLTAAHC-RKPV-FRIRLGHHSMSPVYESGQ 132

  Fly   106 QRQVDFGRV-HEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSY 169
            |.......: |..|:......|:.|:.:|.....:..|:|..:.|..........:.|||...|.
  Rat   133 QMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRASHSVKPVEITSDCPKEGTRCMVSGWGTTSSS 197

  Fly   170 IFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPS 234
            ..:..|.||.:...:|:.|.||...|  ..|.::..|:.. :..:.:|.||||||::..     .
  Rat   198 HNNFPKVLQCLDITVLSEERCKNSYP--GQIDKTMFCAGD-EAGRDSCQGDSGGPVICN-----G 254

  Fly   235 ELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            :|.|:||||..||...|.|.:||.:..::.||
  Rat   255 KLQGLVSWGDFPCAQPNRPGVYTNLCEFVPWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 69/233 (30%)
Tryp_SPc 37..266 CDD:214473 67/231 (29%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.