DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and LOC101732100

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:267 Identity:76/267 - (28%)
Similarity:124/267 - (46%) Gaps:24/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLIN 71
            |:..|..|..:...:||:            ::.|.:|:....|:...|   :....:.|||||::
 Frog    19 TICEAEKACGKSVAISDR------------IVGGQDAKKGKYPWQALL---WCPGVYRCGGTLVS 68

  Fly    72 KDWIVTAAHCISEPVG--MSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNE 134
            ..|:|:||||:|....  :::|.|.:..:..:.......|....:|..|.......||.|..:.:
 Frog    69 SKWVVSAAHCLSRSNASCLAVILGANKLSGNENEEMAVSVKNIYIHPNYNDTDITNDIGLAELTQ 133

  Fly   135 SFIFNEWVQPATLPSREQV-HEGET-HLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPES 197
            :..|..:|.|..||:...: :.|:: .:.|||..:........|||.|..:||:.|:|:.....:
 Frog   134 AVSFTSYVIPVCLPTASTIFNPGQSCWVTGWGVTEFNTSLSPNTLQEVQMRILSAEQCRSYYDPN 198

  Fly   198 AP---IAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKV 259
            ..   |.:..||:..:...|.:|.||||||||..: .....|:|:||:| |.||....|.:||.|
 Frog   199 ITGVYITDQMICARDILGGKDSCQGDSGGPLVCSY-GGNFYLVGVVSFG-IGCGDTAYPGVYTYV 261

  Fly   260 SAYIDWI 266
            .||.|||
 Frog   262 PAYRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/237 (30%)
Tryp_SPc 37..266 CDD:214473 69/235 (29%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.