DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and tmprss9

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:252 Identity:78/252 - (30%)
Similarity:118/252 - (46%) Gaps:27/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISE----PVGMSIIAGL 94
            |..::.|::|.....|:.|||..|   :.|.||.|:|...|:|:||||.::    .|.::.|| .
 Frog   232 TNRIVGGSDATKGEFPWQVSLREN---NEHFCGATVIGDKWLVSAAHCFNDFQDPAVWVAYIA-T 292

  Fly    95 HTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETH 159
            .:.:..|..|.:..:.....|..|......||:|:|.::....||::.||..||.       .||
 Frog   293 TSLSGTDSSTVKATIRNIIKHPSYDPDTADYDVAVLELDSPLKFNKYTQPVCLPD-------PTH 350

  Fly   160 LY---------GWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKS 215
            ::         |||..|.......:.||..|..|::...|....  |..:.|..:|:..|:....
 Frog   351 VFPVGKKCIITGWGYLKEDNLVKPEVLQKATVAIMDQSLCNSLY--SNVVTERMLCAGYLEGKID 413

  Fly   216 ACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQSA 272
            :|.||||||||.|..:....|.|||||| :.|..|..|.:|.:||...:||.:|.|:
 Frog   414 SCQGDSGGPLVCEEPSGKFFLAGIVSWG-VGCAEARRPGVYVRVSKIRNWILDIISS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 75/244 (31%)
Tryp_SPc 37..266 CDD:214473 73/241 (30%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473 73/242 (30%)
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.