DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and tmprss6

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:257 Identity:75/257 - (29%)
Similarity:117/257 - (45%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-----SEPVGMSIIAGLHT 96
            ::.||:|:....|:..||   .::..|||||||:...||:|||||.     :.|...::..|   
 Frog   571 LVGGTQAQEGEWPWQASL---QVRGEHICGGTLVADQWILTAAHCFTPESYASPEVWTVYLG--- 629

  Fly    97 RAEVDELTQQ-------RQVDFGRVHEKYTGGVGPYDIALLHVNESF-IFNEWVQPATLPSREQV 153
            :..:...||:       |.|    :|..|......||:||:.::... :.:..|||..|||    
 Frog   630 KVRLSRSTQKELAFKVIRLV----IHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICLPS---- 686

  Fly   154 HEGETHLY---------GWGQPKSYIFSG--AKTLQTVTTQILNYEECKEELPESAPIAESNICS 207
               .||.:         |||..|.   :|  :..||.|..|::..:.|.|..  ...|:...:|:
 Frog   687 ---STHHFPTGSSCWVTGWGSVKE---NGPTSDVLQKVDIQLVAQDICTELY--RYQISPRMLCA 743

  Fly   208 SSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNI 269
            .....||.||.||||.|||.:..:......|:|||| ..||:.....:|::::..:.||.:|
 Frog   744 GYRDGSKDACQGDSGSPLVCKTASGRWFQAGLVSWG-AGCGIPRYFGVYSRITRLVQWIESI 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 74/255 (29%)
Tryp_SPc 37..266 CDD:214473 72/252 (29%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.