DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and LOC100004427

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:255 Identity:69/255 - (27%)
Similarity:113/255 - (44%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSH-ICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEV 100
            ::.|..|...|.|:..|:  |:..... .|.|:||::.|::|||.|..             |..|
Zfish    36 IVGGLNATEGSWPWQASI--NFKSTGQFFCSGSLISERWVLTAASCFQ-------------RINV 85

  Fly   101 DELTQQRQVDFGRVHEKYTGGVGPY-------------DIALLHVNESFIFNEWVQPATLPSREQ 152
            .::.    :..||:   .|.|..||             ||||:.::.|..|.::::|..|.:...
Zfish    86 SDVV----IYLGRL---TTNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCLAAAGS 143

  Fly   153 VH-EG-ETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQS-K 214
            |. :| |:.:.|||...|.....:..|:.|...|:|..||..  .......::.||:..:.:: |
Zfish   144 VFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSN--INGITNLDNVICAGFVNETGK 206

  Fly   215 SACNGDSGGPLVVEFTNAPSELI--GIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQSA 272
            :.|..|.|.|||   |...|:.|  |:|.:.:  ||....|::|.:||.|.:||.|..|:
Zfish   207 APCWEDFGSPLV---TRQGSQWIQSGVVVFTF--CGQNGFPTLYARVSEYEEWIRNYTSS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 67/250 (27%)
Tryp_SPc 37..266 CDD:214473 65/247 (26%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 65/247 (26%)
Tryp_SPc 36..257 CDD:238113 67/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.