DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:263 Identity:75/263 - (28%)
Similarity:112/263 - (42%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL------TYNQGQAVAG--AH 85
            ||:.|...|.|..|:..|: .....|.|.||:|....:||||||:      ..:..:..||  :|
Human   217 RIVGGQSVAPGRWPWQASV-ALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSH 280

  Fly    86 SRTDQENVQIRKFTNA---QYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSL 147
            |       .:|....|   :.:.|..|.......|:.|:.|:         .|.:.|:.|.||.|
Human   281 S-------AVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQ---------TALNFSDTVGAVCL 329

  Fly   148 PSKT--FQGTSDGYLYGWGRDNSG-----------LLPLNLQKLDAIIVDYNECKAALPSNNSLA 199
            |:|.  |...|..::.|||..:..           ::||...:|         |.::...:.:|.
Human   330 PAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQL---------CNSSCVYSGALT 385

  Fly   200 ETNVCT-HTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPW 263
            ...:|. :..|:|| :|.||||||||....... .|:|:|||| ..|....:|.||..|:.||.|
Human   386 PRMLCAGYLDGRAD-ACQGDSGGPLVCPDGDTW-RLVGVVSWG-RGCAEPNHPGVYAKVAEFLDW 447

  Fly   264 IDE 266
            |.:
Human   448 IHD 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 73/259 (28%)
Tryp_SPc 30..267 CDD:238113 74/262 (28%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133
Tryp_SPc 217..448 CDD:214473 73/259 (28%)
Tryp_SPc 218..451 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.