DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Tmprss5

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:305 Identity:82/305 - (26%)
Similarity:119/305 - (39%) Gaps:67/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KQFAVIFALALASVSAISVPQPGFPEGRIIN-----------------GYEAAKGEAPYIVSLQT 49
            ::||.:.|.....|.....|....|.|||::                 |...|.|..|:..|:..
Mouse   173 QEFAQLSARPGGLVEESWKPSANCPSGRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVML 237

  Fly    50 TSNSHFCAGSLLDEVTIVTAAHCL-----------TYNQGQAVAGA---HSRTDQENVQIRKFTN 100
            .|. |.|..|:|....:||||||:           ..:.|....||   |..|..|.:       
Mouse   238 GSR-HTCGASVLAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKI------- 294

  Fly   101 AQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKT--FQGTSDGYLYGW 163
               :.|..|.......|:.|:.|:....|         |:.|.||.||:|.  |...|..::.||
Mouse   295 ---IPHPLYSAQNHDYDVALLQLRTPINF---------SDTVGAVCLPAKEQHFPWGSQCWVSGW 347

  Fly   164 GRDNSGLLPLNLQKLDAI------IVDYNECKAALPSNNSLAETNVCT-HTPGKADGSCNGDSGG 221
            |..:    |.:....|.:      ::....|.::...:.:|....:|. :..|:|| :|.|||||
Mouse   348 GHTD----PSHTHSSDTLQDTMVPLLSTYLCNSSCMYSGALTHRMLCAGYLDGRAD-ACQGDSGG 407

  Fly   222 PLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |||..|.... .|:|:|||| ..|.....|.||..|:.||.||.:
Mouse   408 PLVCPSGDTW-HLVGVVSWG-RGCAEPNRPGVYAKVAEFLDWIHD 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 73/274 (27%)
Tryp_SPc 30..267 CDD:238113 74/277 (27%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 9/39 (23%)
Tryp_SPc 217..448 CDD:214473 71/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.