DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss36

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:282 Identity:82/282 - (29%)
Similarity:122/282 - (43%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SAISVPQPGF---------PEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAH 71
            |.:|..|..|         |..||:.|.:|..|..|:.|||. ....|.|.|||:....:::|||
Mouse    25 SVVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLH-QGGGHICGGSLIAPSWVLSAAH 88

  Fly    72 CLTYN-------QGQAVAGAHSRTDQ-ENVQIRKFTNAQYVIHENYGGGVGPNDIG--LILLKEE 126
            |...|       :...:.|.||:... |...:|..  |..:|.:||    ...::|  |.||:  
Mouse    89 CFVTNGTLEPADELSVLLGVHSQDGPLEGAHMRSV--ATILIPDNY----STVELGADLALLR-- 145

  Fly   127 DAFDLNAVARDGSNPVSAVSLP--SKTFQGTSDGYLYGWGRDNSGL---LPLNLQKLDAIIVDYN 186
                |.:.|:.|.: |..|.||  |..|...:..:..|||.....:   ||..||:::..::...
Mouse   146 ----LASPAKLGPS-VRPVCLPRASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEA 205

  Fly   187 ECKAAL----PSNNS--LAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPC 245
            .|:...    |.|.:  |....:|...|.....:|.||||||||.:...|.. |.||.|:|: .|
Mouse   206 ACQCLYSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWF-LAGITSFGF-GC 268

  Fly   246 LSTTYPSVYTSVSSFLPWIDEN 267
            .....|.|:|:|:.:..||.|:
Mouse   269 GRRNRPGVFTAVAPYESWIREH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 74/255 (29%)
Tryp_SPc 30..267 CDD:238113 75/257 (29%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 75/257 (29%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.