DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss54

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:240 Identity:58/240 - (24%)
Similarity:101/240 - (42%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHSRTDQENVQIRKFTNAQYV 104
            |.|::||:|....:|...|.:|.|..|::.|..|.:.:........|..|......|:::....:
Mouse    88 EFPWVVSIQDKQYTHLAFGCILSEFWILSTASALQHRKEVIAVVGISNMDPRKTDHREYSVNTII 152

  Fly   105 IHENYGG-GVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQ---GTSDGYLYGWGR 165
            .|||:.. .:|.|   :.|||.|.|...|.:       |.|:....|...   ...:.::.||..
Mouse   153 PHENFDNVSMGNN---IALLKTESAMHFNDL-------VQAICFLGKKLHKPPALKNCWVAGWNP 207

  Fly   166 DNSGLLPLNLQKLDAIIV-DYNECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSS 229
            .::....:.:..|..|.| |...|    |.... .:|...:||. :.:..|.|:.|.|::.|:..
Mouse   208 TSATGNHMTMSILRRISVKDIEVC----PLRRH-QKTECASHTK-EPNNVCLGEPGSPMMCQAKK 266

  Fly   230 RGAELI-GIVSWGYTPCLSTTYPS--VYTSVSSFLPWID-ENRKA 270
            ....:: |::::|...|     |.  :||||:.:..||. :.|||
Mouse   267 LDLWILRGLLAYGGDSC-----PGLFLYTSVADYSDWITAKTRKA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 53/231 (23%)
Tryp_SPc 30..267 CDD:238113 55/235 (23%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 53/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24250
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.