DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and ctrb.2

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:270 Identity:89/270 - (32%)
Similarity:122/270 - (45%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFALALASVSAISVPQPGFPE-----GRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVT 65
            ::..|||.. :|.....|..|.     .||:||.||.....|:.||||.::..|||.|||::|..
Zfish     6 ILLCLALIG-TAYGCGVPAIPPVITGYARIVNGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEWW 69

  Fly    66 IVTAAHCLTYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFD 130
            :||||||......:.:.|.|.|:.... .|:..|..:...|.|:......|||.||.|       
Zfish    70 VVTAAHCNVRTSHRVILGEHDRSSNAE-SIQTMTVGKVFKHPNFNMFTINNDILLIKL------- 126

  Fly   131 LNAVARDGSNPVSAVSL--PSKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAA 191
              |.....:..||.|.|  .:..|.|.......|||  :.|:...|..||:....::...:||..
Zfish   127 --ATPAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAALPLLTNEDCKRF 189

  Fly   192 LPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTS 256
            .  .|.:.:..||....|.:  ||.||||||||.|...... |:||||||.:.| |.:.|.||..
Zfish   190 W--GNKITDLMVCAGASGAS--SCMGDSGGPLVCQKDGVWT-LVGIVSWGSSVC-SPSSPGVYAR 248

  Fly   257 VSSFLPWIDE 266
            |:....|:|:
Zfish   249 VTKLRAWVDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 81/238 (34%)
Tryp_SPc 30..267 CDD:238113 82/241 (34%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 81/238 (34%)
Tryp_SPc 34..259 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.