DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and TMPRSS3

DIOPT Version :10

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:269 Identity:81/269 - (30%)
Similarity:109/269 - (40%) Gaps:69/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYN---------QGQAVAGA 84
            ||:.|..:...:.|:..||| ....|.|.||::..:.|:|||||: |:         |...|:..
Human   216 RIVGGNMSLLSQWPWQASLQ-FQGYHLCGGSVITPLWIITAAHCV-YDLYLPKSWTIQVGLVSLL 278

  Fly    85 HSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPS 149
            .:......|:       :.|.|..|......|||.|:.|.....|         :..:..|.||:
Human   279 DNPAPSHLVE-------KIVYHSKYKPKRLGNDIALMKLAGPLTF---------NEMIQPVCLPN 327

  Fly   150 KTFQGTSDG---YLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTH--- 206
            .. :...||   :..|||  .|.:|         ||..| .|.  ||:|    |....:|.|   
Human   328 SE-ENFPDGKVCWTSGWGATEDGAG---------DASPV-LNH--AAVP----LISNKICNHRDV 375

  Fly   207 -----TP---------GKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSV 257
                 :|         |..| ||.||||||||.| ..|..:|:|..|:| ..|.....|.|||.|
Human   376 YGGIISPSMLCAGYLTGGVD-SCQGDSGGPLVCQ-ERRLWKLVGATSFG-IGCAEVNKPGVYTRV 437

  Fly   258 SSFLPWIDE 266
            :|||.||.|
Human   438 TSFLDWIHE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 78/265 (29%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:464747
Tryp_SPc 216..444 CDD:214473 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.