DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and tmprss5

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:247 Identity:82/247 - (33%)
Similarity:121/247 - (48%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL-TYNQGQ-----AVAGAHSR 87
            |||.|.|||.|..|:.|||. .:|.|.|.||::....|||||||: .|...|     ..||..:.
Zfish   311 RIIGGVEAALGRWPWQVSLY-YNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITS 374

  Fly    88 TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLP--SK 150
            ...:..|.:.|...:.:.::||......|||.|:.||....|         |:.:..|.||  ..
Zfish   375 NLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNF---------SDTIRPVCLPQYDH 430

  Fly   151 TFQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCT-HTPGKAD 212
            ...|.:..::.|||  :.:..|:|..|::....::...:|.::...|..:....:|. ::.||.|
Zfish   431 DLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNGEITSRMLCAGYSEGKVD 495

  Fly   213 GSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
             :|.||||||||.|..:.. .|:|:|||| |.|....:|.||:.|:.||.||
Zfish   496 -ACQGDSGGPLVCQDENVW-RLVGVVSWG-TGCAEPNHPGVYSKVAEFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 80/245 (33%)
Tryp_SPc 30..267 CDD:238113 81/246 (33%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 80/245 (33%)
Tryp_SPc 312..547 CDD:238113 81/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.