DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and PRTN3

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:263 Identity:84/263 - (31%)
Similarity:120/263 - (45%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSN--SHFCAGSLLDEVTIVTAAHCL 73
            |||||....:.........|:.|:||.....||:.|||...|  ||||.|:|:....::||||||
Human     9 ALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCL 73

  Fly    74 ---TYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVA 135
               .......|.|||:...||..| :.|:.|| |...||......||:  :|::.....:|:|  
Human    74 RDIPQRLVNVVLGAHNVRTQEPTQ-QHFSVAQ-VFLNNYDAENKLNDV--LLIQLSSPANLSA-- 132

  Fly   136 RDGSNPVSAVSLPSKTFQGTSDG---YLYGWGRDNSGLLPLN-LQKLDAIIVDYNECKAALPSNN 196
                 .|:.|.||.:. |....|   ...||||..:...|.. ||:|:..:|.: .|:       
Human   133 -----SVATVQLPQQD-QPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF-FCR------- 183

  Fly   197 SLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFL 261
               ..|:||..|.:..|.|.|||||||:.....:|.:  ..|.||   |.:..:|..:|.|:.::
Human   184 ---PHNICTFVPRRKAGICFGDSGGPLICDGIIQGID--SFVIWG---CATRLFPDFFTRVALYV 240

  Fly   262 PWI 264
            .||
Human   241 DWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 77/243 (32%)
Tryp_SPc 30..267 CDD:238113 79/244 (32%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.