DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and zgc:100868

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:250 Identity:83/250 - (33%)
Similarity:114/250 - (45%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHC---------LTYNQGQAVAGA 84
            ||:.|..|..|..|:.|||| ...||||.|||::...|:|||||         |.|...|.:|..
Zfish    36 RIVGGQNAPVGAWPWQVSLQ-RDGSHFCGGSLINNQWILTAAHCFPNPSTTGLLVYLGLQKLASF 99

  Fly    85 HSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPS 149
            .|.:....|       :..:.|.||......|||.|:.|....:|. |.:     .|:...:..|
Zfish   100 ESYSMSSAV-------SNIIKHPNYNSDTEDNDITLLQLASTVSFS-NYI-----RPICLAASDS 151

  Fly   150 KTFQGTSDGYLYGWGRDNSGL---LPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGKA 211
            ..|.||. .::.|||...:|:   .|..||::...||...:|. .|...:.:.:..||.......
Zfish   152 TFFNGTL-VWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKCN-CLYGVSKITDNMVCAGLLQGG 214

  Fly   212 DGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            ..||.||||||:||:..|...: .||||:| |.|....:|.|||.||.:..||.:
Zfish   215 KDSCQGDSGGPMVSKQGSVWIQ-SGIVSFG-TGCAQPNFPGVYTRVSKYQSWIQQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 81/246 (33%)
Tryp_SPc 30..267 CDD:238113 82/248 (33%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 81/246 (33%)
Tryp_SPc 37..267 CDD:238113 82/247 (33%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.