DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and ctrb.3

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:259 Identity:91/259 - (35%)
Similarity:124/259 - (47%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQ 79
            |.||.....|:  .||:||.||.....|:.||||..:..|||.|||::|..:||||||......:
Zfish    21 VPAIPPVVSGY--ARIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLINEFWVVTAAHCSVRTSHR 83

  Fly    80 AVAGAHSR---TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNP 141
            .:.|.|::   ..||::|..|.  ::...|..|......|||.|:.|....:  |||       .
Zfish    84 VILGEHNKGKSNTQEDIQTMKV--SKVFTHPQYNSNTIENDIALVKLTAPAS--LNA-------H 137

  Fly   142 VSAVSL--PSKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETN 202
            ||.|.|  .|..|.........|||  |.|:...|..||::...::...:||....||  :.:|.
Zfish   138 VSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDCKNHWGSN--IRDTM 200

  Fly   203 VCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            :|....|.:  ||.||||||||.|..:... |:||||||.:.| ..|.|.||..|:....|:|:
Zfish   201 ICAGAAGAS--SCMGDSGGPLVCQKDNIWT-LVGIVSWGSSRC-DPTMPGVYGRVTELRDWVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 85/241 (35%)
Tryp_SPc 30..267 CDD:238113 86/244 (35%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 85/241 (35%)
Tryp_SPc 34..261 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.