DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss44

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:125/278 - (44%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SVSAISVPQPGFP------------EGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTI 66
            |.|::|:.:..||            ..||:.|..|...:.|:.|||| ....|.|.|||:.:..:
  Rat    85 SFSSMSLSRQSFPPWIPPTSACGHRTARIVGGKPAPIRKWPWQVSLQ-VHKQHICGGSLISKWWV 148

  Fly    67 VTAAHC----LTY--NQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYG-GGVGPNDIGLILLK 124
            :|||||    |.|  :.|:|        |..:....|......::|::|. .....:||.|:|| 
  Rat   149 MTAAHCVYGHLDYVVSMGEA--------DLWSSMSVKIPVQDIIVHQDYSVMRTIVHDIALVLL- 204

  Fly   125 EEDAFDLNAVARDGSNPVSAVSLPSKTF--QGTSDGYLYGWGRD-NSGLLPLNLQKLDAIIVDYN 186
               ||.:|.     |..:..|.:|.|:|  |..:..::.|||:. ..|.....|:::|..|:.:.
  Rat   205 ---AFPVNY-----SVNIQPVCIPEKSFLVQPGTLCWVTGWGKTIERGRSSRVLREVDLSIIRHE 261

  Fly   187 ECKAALPSNNS-----LAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCL 246
            .|...|.....     :.|..||.:.. |...:|.||||||:|.:.:....: :|||||| ..|.
  Rat   262 RCNQILKDITGRIFTLVQEGGVCGYNK-KGGDACQGDSGGPMVCEFNKTWVQ-VGIVSWG-LGCG 323

  Fly   247 STTYPSVYTSVSSFLPWI 264
            ...||.:||.||.:..||
  Rat   324 RIGYPGIYTEVSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 75/249 (30%)
Tryp_SPc 30..267 CDD:238113 76/250 (30%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 75/249 (30%)
Tryp_SPc 113..341 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.