DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss53

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:301 Identity:61/301 - (20%)
Similarity:109/301 - (36%) Gaps:85/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHSR 87
            ||.||.:..|   ...||.|:..|:: ....|.|:|||:.:..::|||||.              
  Rat    33 PGPPEPQEGN---TLPGEWPWQASVR-RQGVHICSGSLVADTWVLTAAHCF-------------- 79

  Fly    88 TDQENVQIRKFTNAQYVIHENYGGGVGP--NDIGLILLKEEDAFDLNAVARD-----GSNPV--S 143
               |.:...:.::...|:......|:.|  .::|:..|:...|::..:...|     .::|:  :
  Rat    80 ---EKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPIVHT 141

  Fly   144 AVSLPSKTF--------------QGTSDGYLYGWGRD----------------------NSGLLP 172
            .:.||..|.              |.||||......:.                      :|.|.|
  Rat   142 TLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSP 206

  Fly   173 L----NLQKLDAIIVDYNECKA----------ALPSNNSLAETNVCTHTPGKADGSCNGDSGGPL 223
            |    .|:.|...::....|..          |.|:.:.:    :|........|.|.||||||:
  Rat   207 LPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARSGM----LCGGAQPGVQGPCQGDSGGPV 267

  Fly   224 VSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            :.:........:||:|: .:.|.....|.:.|.:::...|:
  Rat   268 MCREPDGHWVQVGIISF-TSNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 56/293 (19%)
Tryp_SPc 30..267 CDD:238113 57/294 (19%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 56/286 (20%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.