DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss36

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:281 Identity:82/281 - (29%)
Similarity:126/281 - (44%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SAISVPQPGF---------PEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAH 71
            ||:|..|..|         |..||:.|.:|..|..|:.|||. ....|.|.|||:....:::|||
  Rat    36 SAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLH-HGGGHICGGSLIAPSWVLSAAH 99

  Fly    72 CLTYN-------QGQAVAGAHSRTDQ-ENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDA 128
            |...|       :...:.|.||:... |...:|..  |..::.:||.......|:.|:.|.    
  Rat   100 CFVTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSV--ATILVPDNYSRVELGADLALLRLA---- 158

  Fly   129 FDLNAVARDGSNPVSAVSLP--SKTFQGTSDGYLYGWG--RDNSGL-LPLNLQKLDAIIVDYNEC 188
                :.|:.|.: |..|.||  |..|...:..:..|||  :::..| :|..||:::..::....|
  Rat   159 ----SPAKLGPS-VKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETAC 218

  Fly   189 KAAL----PSNNS--LAETNVCTHTP-GKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCL 246
            :...    |.|.:  |....:|...| |:.| :|.||||||||.:...|.. |.||.|:|: .|.
  Rat   219 QCLYSRPGPFNLTLQLLPGMLCAGYPEGRRD-TCQGDSGGPLVCEDGGRWF-LAGITSFGF-GCG 280

  Fly   247 STTYPSVYTSVSSFLPWIDEN 267
            ....|.|:|:|:.:..||.|:
  Rat   281 RRNRPGVFTAVAHYESWIREH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 73/254 (29%)
Tryp_SPc 30..267 CDD:238113 74/256 (29%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 74/256 (29%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.