DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and CTRB2

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:254 Identity:93/254 - (36%)
Similarity:126/254 - (49%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHSR-TDQEN 92
            ||:||.:|..|..|:.||||..:..|||.|||:.|..:||||||........|||...: :|:||
Human    33 RIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEEN 97

  Fly    93 VQIRK----FTNAQY-VIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSK-- 150
            :|:.|    |.|.:: ::..|       |||.|:.|.....|         |..||||.|||.  
Human    98 IQVLKIAKVFKNPKFSILTVN-------NDITLLKLATPARF---------SQTVSAVCLPSADD 146

  Fly   151 -----TFQGTSDGYLYGWGRD--NSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTP 208
                 |...|:     |||:.  |:...|..||:....::...|||.:.  ...:.:..:|....
Human   147 DFPAGTLCATT-----GWGKTKYNANKTPDKLQQAALPLLSNAECKKSW--GRRITDVMICAGAS 204

  Fly   209 GKADGSCNGDSGGPLVSQSSSRGA-ELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |.:  ||.||||||||.|..  || .|:||||||...| |||.|:||..|:..:||:.:
Human   205 GVS--SCMGDSGGPLVCQKD--GAWTLVGIVSWGSRTC-STTTPAVYARVAKLIPWVQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 92/250 (37%)
Tryp_SPc 30..267 CDD:238113 92/253 (36%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 92/250 (37%)
Tryp_SPc 34..259 CDD:238113 92/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.