DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Tmprss9

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:259 Identity:86/259 - (33%)
Similarity:122/259 - (47%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPGF-PEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQ------ 79
            ||.: ..|||:.|.|||.||.|:.|||: .::.|||..:::....:|:||||  :|:.|      
Mouse   447 QPAWRSAGRIVGGVEAAPGEFPWQVSLR-ENHEHFCGATIIGARWLVSAAHC--FNEFQDPAQWA 508

  Fly    80 AVAGA-H-SRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPV 142
            |.||: | |.::...|:.|....|:   |..|.......|:.::.|.....|         ...|
Mouse   509 AQAGSVHLSGSEASAVRTRVLRIAK---HPAYDADTADFDVAVLELARPLPF---------GRYV 561

  Fly   143 SAVSLPSKT--FQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNV 203
            ....||:.|  |.......:.|||  :::..:.|..|||....::|.:.|.:..  .:||.:..|
Mouse   562 QPACLPAATHVFPPGKKCLISGWGYLKEDFLVKPEVLQKATVELLDQSLCSSLY--GHSLTDRMV 624

  Fly   204 CT-HTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |. :..||.| ||.||||||||.:..|....|.|||||| ..|.....|.|||.|:....||.|
Mouse   625 CAGYLDGKVD-SCQGDSGGPLVCEEPSGRFFLAGIVSWG-IGCAEARRPGVYTRVTRLRDWILE 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 80/247 (32%)
Tryp_SPc 30..267 CDD:238113 82/250 (33%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473 80/247 (32%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.