DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk1c6

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:276 Identity:76/276 - (27%)
Similarity:121/276 - (43%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHC----LT 74
            |:..|....||  :.|::.||:..|...|:.|::.:.|   .|.|.|:|...::|||||    |:
  Rat    11 SMGRIDAAPPG--QSRVVGGYKCEKNSQPWQVAVISRS---LCGGVLIDPSWVITAAHCYSNALS 70

  Fly    75 YNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYG-----------GGVGPNDIGLILLKEEDA 128
            |.  ..:.|.::.::.|.....:|.:..:. |.:|.           |....||:.|:.|.:.  
  Rat    71 YY--HVLLGRNNLSEDEPFAQYRFVSQSFP-HPDYNPFFMRNHTRQPGDDYSNDLMLLHLSKP-- 130

  Fly   129 FDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAA 191
                |...||   |..:.||::..:..|.....|||  :.....||.:||.::..::...:|..|
  Rat   131 ----ADITDG---VKVIDLPTEEPKVGSTCLASGWGSTKPLDWELPDDLQCVNIHLLSNEKCIEA 188

  Fly   192 LPSNNSLAETNVCTHTPGKADG---SCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSV 253
            .  |..:.:..:|.   |..:|   :|.|||||||:..     ..|.||.|||..||.....|::
  Rat   189 Y--NEKVTDLMLCA---GDLEGGKDTCKGDSGGPLICD-----GVLQGITSWGSDPCAEPNMPAI 243

  Fly   254 YTSVSSFLPWIDENRK 269
            ||.:..|..||.|..|
  Rat   244 YTKLIKFTSWIKEVMK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 68/254 (27%)
Tryp_SPc 30..267 CDD:238113 69/256 (27%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.