DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Jon74E

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:280 Identity:83/280 - (29%)
Similarity:127/280 - (45%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFALALASVSAISVPQPGFP-EGRIINGYEAAKGEAPYIVSLQTTSNSH---FCAGSLLDEVTI 66
            ::|.|.|....:||....|.. .|||..|..|...:.||.|.|.....:.   :|..||:.:..:
  Fly     7 LVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYL 71

  Fly    67 VTAAHC------LTYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKE 125
            :|||||      :||..|..:..|..       |:.:.||.:..:|.::......|||.|:.|.|
  Fly    72 LTAAHCVEKAVAITYYLGGVLRLAPR-------QLIRSTNPEVHLHPDWNCQSLENDIALVRLPE 129

  Fly   126 EDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLY------GWGR--DNSGLLPLNLQKLDAII 182
            :      |:..|...|:....|.|     :.:.|.|      ||||  |.|..:..||:.:...:
  Fly   130 D------ALLCDSIRPIRLPGLSS-----SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFV 183

  Fly   183 VDYNECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAE-LIGIVSWGYTPCL 246
            ....:|:.   |..::..||:|..|.| ...:|.||||||||.....:.|: |||:.|:|.....
  Fly   184 ESNEDCEY---SYANIKPTNICMDTTG-GKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC 244

  Fly   247 STTYPSVYTSVSSFLPWIDE 266
            :..||||:|.::::|.||.|
  Fly   245 TKGYPSVFTRITAYLDWIGE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 73/252 (29%)
Tryp_SPc 30..267 CDD:238113 75/255 (29%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.