DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and ovch1

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:266 Identity:73/266 - (27%)
Similarity:120/266 - (45%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTY- 75
            ||.:.:. ||:....|.|||.|.||.....|:.|||| .::...|.|::||::.::||.||... 
Zfish    40 LAGIRSF-VPEDEVEESRIIGGKEAWAHSWPWQVSLQ-YNDVPTCGGAILDQLWVITAGHCFKRY 102

  Fly    76 ---NQGQAVAGAH-----SRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLN 132
               :...||.|.|     :.:.:|::|::|..:     |:||......|||.|:.|:....|   
Zfish   103 KKPSMWNAVVGLHNLDNANESSRESIQVQKIFS-----HKNYNQKTNENDIALLKLQSPLVF--- 159

  Fly   133 AVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSNN 196
                  |..|..:.:.:..........:.|||. ..:|.....||:::..:.:..:|....  ..
Zfish   160 ------SKFVRPIGVFNNDLPPLVTCTVTGWGSVTENGPQASRLQEVNVTVYEPQKCNRFY--RG 216

  Fly   197 SLAETNVCTHTPGKADG---SCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVS 258
            .:.::.:|.   |..:|   :|.|||||||......| .:|.|:|||| ..|.....|.|||::.
Zfish   217 KVLKSMICA---GANEGGMDACQGDSGGPLSCFDGER-YKLAGVVSWG-VGCGRAQKPGVYTTLY 276

  Fly   259 SFLPWI 264
            .:..|:
Zfish   277 HYRQWM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 67/247 (27%)
Tryp_SPc 30..267 CDD:238113 67/248 (27%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 67/246 (27%)
Tryp_SPc 57..281 CDD:238113 66/245 (27%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.