DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and KLKB1

DIOPT Version :10

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:255 Identity:81/255 - (31%)
Similarity:119/255 - (46%) Gaps:30/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQT--TSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHS----- 86
            ||:.|..::.||.|:.||||.  |:..|.|.|||:....::|||||......|.|...:|     
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNL 465

  Fly    87 ---RTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLP 148
               ..|....||:     :.:||:||....|.:||.||.|:.    .||..  :...|   :.||
Human   466 SDITKDTPFSQIK-----EIIIHQNYKVSEGNHDIALIKLQA----PLNYT--EFQKP---ICLP 516

  Fly   149 SKTFQGT--SDGYLYGWG-RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGK 210
            ||....|  ::.::.||| ....|.:...|||::..:|...||:... .:..:.:..||......
Human   517 SKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRY-QDYKITQRMVCAGYKEG 580

  Fly   211 ADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDENRKA 270
            ...:|.||||||||.:.:... .|:||.||| ..|.....|.|||.|:.::.||.|..::
Human   581 GKDACKGDSGGPLVCKHNGMW-RLVGITSWG-EGCARREQPGVYTKVAEYMDWILEKTQS 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 78/247 (32%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 77/246 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.