DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and KLK2

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:284 Identity:79/284 - (27%)
Similarity:123/284 - (43%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFAVIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVT 65
            |....:..||::....|:.:.|     .||:.|:|..|...|:.|::.:...:| |.|.|:....
Human     1 MWDLVLSIALSVGCTGAVPLIQ-----SRIVGGWECEKHSQPWQVAVYSHGWAH-CGGVLVHPQW 59

  Fly    66 IVTAAHCLTYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDI-GLILLK----- 124
            ::||||||..| .|...|.|:..:.|:      |..:..:..::     |:.: .:.|||     
Human    60 VLTAAHCLKKN-SQVWLGRHNLFEPED------TGQRVPVSHSF-----PHPLYNMSLLKHQSLR 112

  Fly   125 --EEDAFDLNAVARDGSNP------VSAVSLPSKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLD 179
              |:.:.||..:..  |.|      |..:.||::.....:..|..|||  .....|.|.:||.:.
Human   113 PDEDSSHDLMLLRL--SEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVS 175

  Fly   180 AIIVDYNECKAALPSNNSLAETNVCT--HTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGY 242
            ..::..:.|..|.  :..:.|..:|.  .|.||  .:|.||||||||.     ...|.||.|||.
Human   176 LHLLSNDMCARAY--SEKVTEFMLCAGLWTGGK--DTCGGDSGGPLVC-----NGVLQGITSWGP 231

  Fly   243 TPCLSTTYPSVYTSVSSFLPWIDE 266
            .||.....|:|||.|..:..||.:
Human   232 EPCALPEKPAVYTKVVHYRKWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 72/252 (29%)
Tryp_SPc 30..267 CDD:238113 73/255 (29%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.