DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Ctrc

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:276 Identity:84/276 - (30%)
Similarity:120/276 - (43%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFALALASVSAISVPQPGFPEG---RIINGYEAAKGEAPYIVSLQTTSNS---HFCAGSLLDEVT 65
            :.|..||..|...  .|.||..   |::.|.:|.....|:.||||...:.   |.|.|||:....
  Rat     6 VLAAILACASCCG--NPAFPPNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSH 68

  Fly    66 IVTAAHCL----TYNQGQAVAGAHSRT-DQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKE 125
            ::|||||:    ||..|   .|.::.| :.|...:....:..|| ||.:......|||.:|.|.|
  Rat    69 VLTAAHCINKDFTYRVG---LGKYNLTVEDEEGSVYAEVDTIYV-HEKWNRLFLWNDIAIIKLAE 129

  Fly   126 EDAFDLNAVARDGSNPVSAVSLPSKTFQGTSD--GYLYGWGR--DNSGLLPLNLQKLDAIIVDYN 186
            ....         ||.:....:|.:......|  .|:.||||  .|..:..:..|.|.. ||.:.
  Rat   130 PVEL---------SNTIQVACIPEEGSLLPQDYPCYVTGWGRLWTNGPIAEVLQQGLQP-IVSHA 184

  Fly   187 ECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTP-CLSTTY 250
            .|.........:.:|.||....| ...:|||||||||..|:.....::.||||:|.:. |.....
  Rat   185 TCSRLDWWFIKVRKTMVCAGGDG-VISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHKK 248

  Fly   251 PSVYTSVSSFLPWIDE 266
            |.|:|.||::..||:|
  Rat   249 PVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 74/247 (30%)
Tryp_SPc 30..267 CDD:238113 76/250 (30%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 74/247 (30%)
Tryp_SPc 30..265 CDD:238113 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24250
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.