DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and kappaTry

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:277 Identity:90/277 - (32%)
Similarity:138/277 - (49%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQ-----TTSNSHFCAGSLLDEVT 65
            ::.|:..:||.:||    |.||||||||........||:|||:     .:|..|.|||.::.|..
  Fly     6 LLLAIGFSSVISIS----GQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQA 66

  Fly    66 IVTAAHCLTYNQGQ-----AVAGAHSR--TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILL 123
            ::|:|.|| |...:     |||||::|  ||.....:..:|:     |.||......||||::||
  Fly    67 LITSAQCL-YGLPEETKLVAVAGANTRNGTDGFIYPVANWTH-----HPNYDPVTVDNDIGVLLL 125

  Fly   124 KEEDAFDLNAVARDGSNPVSAVSL-PSKTFQGTSDGYLYGWG-RDNSGLLPLNLQKLDAIIVDYN 186
              :...||..:.      :|::.: |.:...|.. ..:.||| |:..|.....|::.:..:|...
  Fly   126 --DTTLDLTLLG------ISSIGIRPERPAVGRL-ATVAGWGYREEWGPSSYKLEQTEVPVVSSE 181

  Fly   187 ECKAALPSNNSLAETNVCTH--TPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTT 249
            :| ..:.....:.|..:|..  ..|.:| :|.||:|||||..     .:|:|:|||| ..|....
  Fly   182 QC-TQIYGAGEVTERMICAGFVVQGGSD-ACQGDTGGPLVID-----GQLVGLVSWG-RGCARPN 238

  Fly   250 YPSVYTSVSSFLPWIDE 266
            ||:||..|:||:.||:|
  Fly   239 YPTVYCYVASFVDWIEE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 78/250 (31%)
Tryp_SPc 30..267 CDD:238113 80/253 (32%)
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 78/250 (31%)
Tryp_SPc 26..256 CDD:238113 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.