DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:250 Identity:80/250 - (32%)
Similarity:114/250 - (45%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQ------AVAGAHS 86
            |||:.|.||:.||.|:..||: .:..|||..::::...:|:||||  :|:.|      |..||..
Human   235 GRIVGGMEASPGEFPWQASLR-ENKEHFCGAAIINARWLVSAAHC--FNEFQDPTKWVAYVGATY 296

  Fly    87 RTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKT 151
            .:..|...:|... .|.|.|..|.......|:.::.|.....|         ...:..|.||:.|
Human   297 LSGSEASTVRAQV-VQIVKHPLYNADTADFDVAVLELTSPLPF---------GRHIQPVCLPAAT 351

  Fly   152 --FQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCT-HTPGKA 211
              |..:....:.|||  :::..:.|..|||....::|...|.:..  .:||.:..||. :..||.
Human   352 HIFPPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASLY--GHSLTDRMVCAGYLDGKV 414

  Fly   212 DGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            | ||.||||||||.:..|....|.|||||| ..|.....|.||..|:....||.|
Human   415 D-SCQGDSGGPLVCEEPSGRFFLAGIVSWG-IGCAEARRPGVYARVTRLRDWILE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 76/245 (31%)
Tryp_SPc 30..267 CDD:238113 77/247 (31%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.