DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Phae2

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:280 Identity:110/280 - (39%)
Similarity:145/280 - (51%) Gaps:42/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAA 70
            ::.|:.::..|.:::.|   ||||::.|..||...||||||:| ...:|:||.::::...:||||
  Fly    11 LLLAVCVSQGSGLALDQ---PEGRVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWLVTAA 71

  Fly    71 HCLTYNQGQ-----------AVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLK 124
            |||. |:.|           ||||..|.|     |.|:.|:  |||::.|.||..|.|||||.  
  Fly    72 HCLA-NRNQVLGSTLVAGSIAVAGTASTT-----QKRQITH--YVINDLYTGGTVPYDIGLIY-- 126

  Fly   125 EEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWG---RDNSGLLPLNLQKLDAI-IVDY 185
            ...||...|.       |:.|.|||...:.|....|:|||   :.||...|..||:...| |:..
  Fly   127 TPTAFTWTAA-------VAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISL 184

  Fly   186 NECKAALPS-NNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTT 249
            :.|.|||.| ...:..||:||.........|..|||||||     :|..||||||||..||....
  Fly   185 DSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV-----QGNVLIGIVSWGKLPCGQPN 244

  Fly   250 YPSVYTSVSSFLPWIDENRK 269
            .||||..||||:.||..|:|
  Fly   245 SPSVYVQVSSFITWIAANQK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 100/250 (40%)
Tryp_SPc 30..267 CDD:238113 101/252 (40%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 100/250 (40%)
Tryp_SPc 32..262 CDD:238113 101/252 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.