DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and PRSS53

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:313 Identity:65/313 - (20%)
Similarity:107/313 - (34%) Gaps:101/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGFP---EGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL------TYNQG 78
            ||.|   ||..:      .||.|:..|:: ...:|.|:|||:.:..::|||||.      ..|..
Human    33 PGPPKPQEGNTV------PGEWPWQASVR-RQGAHICSGSLVADTWVLTAAHCFEKAAATELNSW 90

  Fly    79 QAVAGAHSR------TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARD 137
            ..|.|:..|      .::..|...:...|    :.:|..|   :|:.|:.|              
Human    91 SVVLGSLQREGLSPGAEEVGVAALQLPRA----YNHYSQG---SDLALLQL-------------- 134

  Fly   138 GSNPVSAVSL----PSKTFQGTSDGYLYGWGRDNSG--LLP-LNLQK---LDAIIVDYNEC---- 188
             ::|.:...|    |:..|...:..:..||.:|.|.  ..| |.|.:   |.::.|....|    
Human   135 -AHPTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQ 198

  Fly   189 KAALPSNNSLAETNVCTHTPGK------------------------------------------A 211
            ...||.:.:||.....:..||.                                          .
Human   199 SPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGV 263

  Fly   212 DGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            .|.|.||||||::...........||:|:. :.|.....|.:.|:.::...|:
Human   264 QGPCQGDSGGPVLCLEPDGHWVQAGIISFA-SSCAQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 59/302 (20%)
Tryp_SPc 30..267 CDD:238113 60/303 (20%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 60/304 (20%)
Tryp_SPc 43..314 CDD:214473 59/300 (20%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.