DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and CG11911

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:288 Identity:108/288 - (37%)
Similarity:156/288 - (54%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFAVIFALALASVS-------AISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTT--SNSHFC 56
            ||...|...:||.:.:       .::...|.|..|.:|||.||....|||||||.|.  .:||.|
  Fly     1 MKLITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHIC 65

  Fly    57 AGSLLDEVTIVTAAHCLTYNQGQA-VAGAHSR------TDQENVQIRKFTNAQYVIHENYGGGVG 114
            .|:|:::..|||||||::...|.: :||.|:|      |.|..|...:       :||.|.||||
  Fly    66 GGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGR-------VHEKYTGGVG 123

  Fly   115 PNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGLL--PLNLQK 177
            |.||.|:.:.|...|         :..|...:|||:......:.:|||||:..|.:.  ...||.
  Fly   124 PYDIALLHVNESFIF---------NEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQT 179

  Fly   178 LDAIIVDYNECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGY 242
            :...|::|.|||..||.:..:||:|:|:.:..::..:||||||||||.:.::..:||||||||||
  Fly   180 VTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGY 244

  Fly   243 TPCLSTTYPSVYTSVSSFLPWIDENRKA 270
            .||.....||:||.||:::.||...:.|
  Fly   245 IPCGLANMPSIYTKVSAYIDWITNIQSA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 97/245 (40%)
Tryp_SPc 30..267 CDD:238113 99/247 (40%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 99/247 (40%)
Tryp_SPc 37..266 CDD:214473 97/244 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 1 1.000 - - FOG0016932
OrthoInspector 1 1.000 - - mtm9701
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.