DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss53

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:102/260 - (39%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHSR 87
            ||.||.:..|   ...||.|:..|:: ....|.|:|||:.:..::|||||.              
Mouse    33 PGPPEPQEGN---TLPGEWPWQASVR-RQGVHICSGSLVADTWVLTAAHCF-------------- 79

  Fly    88 TDQENVQIRKFTNAQYVIH--ENYGGGVGPNDIGLILLKEEDAF-------DLNAVARDGSNPVS 143
               |.:...:.::...|:.  :..|...|..::|:..|:...|:       ||..:........:
Mouse    80 ---EKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPTVQT 141

  Fly   144 AVSLPSKTFQ---GTSDGYLYGWGRDNSGL------LPLNLQKLDAIIVDYNECKAALPSNNSLA 199
            .:.||..|:.   |.| .:..||.::.|.:      |.|.|.........||.....|.||.:..
Mouse   142 TLCLPQPTYHFPFGAS-CWATGWDQNTSDVSRTLRNLRLRLISRPTCNCLYNRLHQRLLSNPARP 205

  Fly   200 ETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            ........||: .|.|.||||||::.:........:||:|: .:.|.....|.:.|.::....|:
Mouse   206 GMLCGGAQPGE-QGPCQGDSGGPVMCREPDGHWVQVGIISF-TSKCAQEDTPVLLTDMAVHSSWL 268

  Fly   265  264
            Mouse   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 56/252 (22%)
Tryp_SPc 30..267 CDD:238113 57/253 (23%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 5/15 (33%)
Tryp_SPc 45..271 CDD:238113 56/245 (23%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.