DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and ctrb.1

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:253 Identity:86/253 - (33%)
Similarity:122/253 - (48%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGFPE-----GRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVA 82
            |..|.     .||:||.||.....|:.||||.::..|||.|||::|..:||||||......:.:.
Zfish    22 PAIPPVVTGYARIVNGEEARPHSWPWQVSLQDSTGFHFCGGSLINENWVVTAAHCNVRTSHRVIL 86

  Fly    83 GAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSL 147
            |.|.|:..... |:.....:.:.|.||......|||.||.|         |.....:..||.|.|
Zfish    87 GEHDRSSNAEA-IQTIAVGKSIKHPNYNSFTINNDILLIKL---------ATPAKINTHVSPVCL 141

  Fly   148 --PSKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTP 208
              .:..|.|.......|||  |.|:...|..||:....::..::||....:|  :.:..:|....
Zfish   142 AETNDNFPGGMKCVTSGWGLTRYNAPDTPALLQQAALPLLTNDDCKRYWGTN--ITDLMICAGAS 204

  Fly   209 GKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |.:  ||.||||||||.: ::|...|:||||||.:.| ||:.|:||..|:....|:|:
Zfish   205 GVS--SCMGDSGGPLVCE-NNRVWTLVGIVSWGSSTC-STSTPAVYARVTKLRAWVDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 82/238 (34%)
Tryp_SPc 30..267 CDD:238113 83/241 (34%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 82/238 (34%)
Tryp_SPc 34..259 CDD:238113 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.