DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and CG33127

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:261 Identity:83/261 - (31%)
Similarity:125/261 - (47%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IINGYEA-AKGEAPYIVSLQTT--SNSHFCAGSLLDEVTIVTAAHCL----TYNQGQAV-----A 82
            ||:||:. .....||:|||..|  :.:|.|..|::.:..::|||||:    |:| |.||     |
  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFN-GDAVGTPVYA 104

  Fly    83 GAHSRTDQENVQIRKFTNAQYV----IHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVS 143
            |..:|::....|:|      ||    .|.::.|..|.::|.|:.:.|  :|:.||       .|.
  Fly   105 GIINRSNVTAAQVR------YVDFASTHRSFNGNAGSDNIALLHVSE--SFEYNA-------RVQ 154

  Fly   144 AVSLPSKTFQGTSDGY------LYGWG-RDNSG-LLPLNLQKLDAIIVDYNECKAALPSNNSLAE 200
            .::||.     .:|.|      .|||| .|..| .....||...|.:::...||..||::..|..
  Fly   155 QIALPD-----INDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTA 214

  Fly   201 TNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWID 265
            ..||:...     :|.||.|.||:....:..|||:|:.||.|.||.....|:|||||..::.||.
  Fly   215 QQVCSQVK-----TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIH 274

  Fly   266 E 266
            :
  Fly   275 Q 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 81/257 (32%)
Tryp_SPc 30..267 CDD:238113 83/261 (32%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 83/261 (32%)
Tryp_SPc 41..273 CDD:214473 81/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 1 1.000 - - FOG0016932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.