DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and CG6048

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:108/270 - (40%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRIINGYEAAKGEAPYIVSLQTTSN-------SHFCAGSLLDEVTIVTAAHC----LTYN----- 76
            ||||||.||:.|...:.|.::...|       .|.|.|||:....::|||||    :.|:     
  Fly    44 GRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVP 108

  Fly    77 --QGQAVAGAHSRTDQEN----------VQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAF 129
              :...|.|...|.::.|          :|:.||..:.|           ..||.|::       
  Fly   109 KEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTY-----------DKDIALLM------- 155

  Fly   130 DLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGLLPLNLQKLDAIIVDYNECKAALPS 194
             ||.....|...:..::|............:.|||....|.:...|..:|..::....|......
  Fly   156 -LNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVSDILMTVDVPMISEEHCINDSDL 219

  Fly   195 NNSLAETNVCTH--TPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSV 257
            .:.:....:|..  ..|:.| :|.||||||||.||     ||.|:|||| ..|.....|.|||.|
  Fly   220 GHLIQPGMICAGYLEVGEKD-ACAGDSGGPLVCQS-----ELAGVVSWG-IQCALPRLPGVYTEV 277

  Fly   258 SSFLPWIDEN 267
            |.:..||.:|
  Fly   278 SYYYDWILQN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 71/264 (27%)
Tryp_SPc 30..267 CDD:238113 72/266 (27%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 71/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.