DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Tmprss9

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:259 Identity:86/259 - (33%)
Similarity:122/259 - (47%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPGF-PEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQ------ 79
            ||.: ..|||:.|.|||.||.|:.|||: .::.|||..:::....:|:||||  :|:.|      
  Rat   230 QPAWRSAGRIVGGAEAAPGEFPWQVSLR-ENHEHFCGATIIGARWLVSAAHC--FNEFQDPAQWA 291

  Fly    80 AVAGA-H-SRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPV 142
            |.||: | |.::...|:.|....|:   |..|.......|:.::.|.....|         ...|
  Rat   292 AQAGSVHLSGSEASAVRARVLRIAK---HPAYNADTADFDVAVLELARPLPF---------GRYV 344

  Fly   143 SAVSLPSKT--FQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNV 203
            ....||:.|  |.......:.|||  :::..:.|..|||....::|.|.|.:..  .:||.:..|
  Rat   345 QPACLPAATHVFPPRKKCLISGWGYLKEDFLVKPEVLQKATVELLDQNLCSSLY--GHSLTDRMV 407

  Fly   204 CT-HTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |. :..||.| ||.||||||||.:..|....|.|:|||| ..|.....|.|||.|:....||.|
  Rat   408 CAGYLDGKVD-SCQGDSGGPLVCEEPSGRFFLAGVVSWG-IGCAEARRPGVYTRVTRLRDWILE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 80/247 (32%)
Tryp_SPc 30..267 CDD:238113 82/250 (33%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.