DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss30

DIOPT Version :10

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:51 Identity:15/51 - (29%)
Similarity:21/51 - (41%) Gaps:10/51 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 PFIGLVGSICSATLGLLTPIVLDTVLRWSTPGAFGVFRWRMVKNV--ILMA 440
            |.|...|.:|   :.:|.|.|.|     ...|.....||...:||  ||::
Mouse    84 PNIYETGDVC---ISILHPPVDD-----PQSGELPSERWNPTQNVRTILLS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.