DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk8

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:243 Identity:69/243 - (28%)
Similarity:102/243 - (41%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHS--RTDQE 91
            :|:.|.|......|:..:| .......|.|.|:.:..::||||| ..::.....|.||  :.|:.
  Rat    32 KILEGQECKPHSQPWQTAL-FQGERLVCGGVLVGDRWVLTAAHC-KKDKYSVRLGDHSLQKRDEP 94

  Fly    92 NVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTS 156
            ..:|:...:.|:....:.......:||.||.|:.      :|...|...|:...:|..|..|.. 
  Rat    95 EQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQN------SANLGDKVKPIELANLCPKVGQKC- 152

  Fly   157 DGYLYGWG-----RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGKADGSCN 216
              .:.|||     ::|   .|..|...:..|...|:|:.|.|  ..:.|..||..:...|| :|.
  Rat   153 --IISGWGTVTSPQEN---FPNTLNCAEVKIYSQNKCERAYP--GKITEGMVCAGSSNGAD-TCQ 209

  Fly   217 GDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            ||||||||.     ...|.||.|||..||.....|.|||.:..:..||
  Rat   210 GDSGGPLVC-----NGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 67/241 (28%)
Tryp_SPc 30..267 CDD:238113 69/242 (29%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.