DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:247 Identity:74/247 - (29%)
Similarity:107/247 - (43%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQG----QAVAGAHSRTD 89
            ||:.|..|.:||.|:..||| ...||.|..:|:....:|:||||...::.    .|..||..:..
  Rat   212 RIVGGTSAEEGEWPWQSSLQ-WDGSHRCGATLISNTWLVSAAHCFRTHKDPSRWTASFGATLQPP 275

  Fly    90 QENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLP--SKTF 152
            :....||:.     ::||.|.......||.|:.|......         :|.|..|.||  :..|
  Rat   276 KLTTGIRRI-----IVHEKYNYPSHDYDIALVELSRPVPC---------TNAVHKVCLPDANHEF 326

  Fly   153 QGTSDGYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCT-HTPGKADGSC 215
            |.....::.|:|. .|.|.....|:::....:|...|......|.::....:|. ...|:.| :|
  Rat   327 QPGQRMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNGAITPRMLCAGFLKGEKD-AC 390

  Fly   216 NGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDEN 267
            .||||||||:........|.|:|||| ..|.....|.|||.|::|..||..|
  Rat   391 QGDSGGPLVTPDVRDVWYLAGVVSWG-DECGQPNKPGVYTRVTAFRDWITSN 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 71/242 (29%)
Tryp_SPc 30..267 CDD:238113 72/244 (30%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 72/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.