DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk7

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:268 Identity:80/268 - (29%)
Similarity:119/268 - (44%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFALALASVSAISVPQPGFPEG-RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTA 69
            |:.:|||.:..          :| |||:||:..:|..|:.|:|......| |.|.|:.|..::||
  Rat    11 VLLSLALETAG----------QGERIIDGYKCKEGSHPWQVALLKGDQLH-CGGVLVGESWVLTA 64

  Fly    70 AHCLTYNQGQAVAGAHSRTDQ-ENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNA 133
            |||   ..||..  .|..:|: |:...::...::...|..|......|||  :|:|.:....:  
  Rat    65 AHC---KMGQYT--VHLGSDKIEDQSAQRIKASRSFRHPGYSTRTHVNDI--MLVKMDKPVKM-- 120

  Fly   134 VARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSG--LLPLNLQKLDAIIVDYNECKAALPSNN 196
                 |:.|..|.||.......:...:.|||...|.  ..|.:|...|..::...|||...  .:
  Rat   121 -----SDKVQKVKLPDHCEPPGTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECKKVY--KD 178

  Fly   197 SLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFL 261
            .|.:|.:|...|.....:||||||||||...:     |.|:||||..||.....|.|||.|..:.
  Rat   179 LLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDT-----LQGLVSWGTYPCGQPNDPGVYTQVCKYQ 238

  Fly   262 PWIDENRK 269
            .|:::..|
  Rat   239 RWLEDTMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 73/237 (31%)
Tryp_SPc 30..267 CDD:238113 73/239 (31%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 73/236 (31%)
Tryp_SPc 26..244 CDD:238113 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.