DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and TMPRSS11E

DIOPT Version :10

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:244 Identity:75/244 - (30%)
Similarity:109/244 - (44%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQG----QAVAGAHSRTD 89
            ||:.|.|..:||.|:..||| ...||.|..:|::...:|:||||.|..:.    .|..|...:..
Human   191 RIVGGTEVEEGEWPWQASLQ-WDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVTIKPS 254

  Fly    90 QENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLP--SKTF 152
            :....:|:.     ::||.|.......||.|..|.....:         :|.|..|.||  |..|
Human   255 KMKRGLRRI-----IVHEKYKHPSHDYDISLAELSSPVPY---------TNAVHRVCLPDASYEF 305

  Fly   153 QGTSDGYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHT-PGKADGSC 215
            |.....::.|:|. .|.|....:|::....::|...|......|:::....:|..: .||.| :|
Human   306 QPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNEPQAYNDAITPRMLCAGSLEGKTD-AC 369

  Fly   216 NGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            .|||||||||..:.....|.|||||| ..|.....|.|||.|::...||
Human   370 QGDSGGPLVSSDARDIWYLAGIVSWG-DECAKPNKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 73/242 (30%)
TMPRSS11ENP_054777.2 SEA 51..147 CDD:460188
Tryp_SPc 192..420 CDD:238113 74/243 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.