DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prss38

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:267 Identity:72/267 - (26%)
Similarity:108/267 - (40%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL-------TYNQ-- 77
            ||.. .|:::.|......:.|:.||:. .:..|.|.||:|:...::|||||.       |::.  
  Rat   107 QPAL-HGKLLGGELTIDRKWPWQVSIH-YAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYV 169

  Fly    78 ---GQAVAGAHSRTDQENVQIRKFTNAQYVIHENY------GGGVGPNDIGLILLKEEDAFDLNA 133
               ...||..|::..:.|         |.:||..:      ||     |:.|:..|....|    
  Rat   170 GITNLEVANKHTQWFEIN---------QVIIHPTFEMFHPVGG-----DVALVQSKSAIVF---- 216

  Fly   134 VARDGSNPVSAVSLPSKTFQGTSD--GYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSN 195
                 |:.|..:.|||... ..||  .:..|||. ...|....:|.:....::...:|:......
  Rat   217 -----SDYVLPICLPSSNL-NLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLT 275

  Fly   196 NSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSF 260
            :.|....:|..........|.||||.|||.:.:....: ||||||| ..|....||.|:.:||.|
  Rat   276 SYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQ-IGIVSWG-RGCAQPLYPGVFANVSYF 338

  Fly   261 LPWIDEN 267
            |.||..|
  Rat   339 LNWIRYN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 66/255 (26%)
Tryp_SPc 30..267 CDD:238113 68/257 (26%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 67/253 (26%)
Tryp_SPc 116..342 CDD:214473 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24250
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.