DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Tmprss5

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:300 Identity:83/300 - (27%)
Similarity:125/300 - (41%) Gaps:57/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KQFAVIFALALASVSAISVPQPGFPEGRIIN-----------------GYEAAKGEAPYIVSLQT 49
            ::||.:.|...:.|.....|....|.|||::                 |...|.|..|:..|:..
  Rat   163 QEFAQLSARPGSLVEEAWQPSTNCPSGRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVML 227

  Fly    50 TSNSHFCAGSLLDEVTIVTAAHCL------TYNQGQAVAG--AHSRTDQ-ENVQIRKFTNAQYVI 105
            .|. |.|..|:|....:||||||:      ..:..:..||  :||...| :...:.|.     :.
  Rat   228 GSR-HTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRVHAGLVSHSAVRQHQGTMVEKI-----IP 286

  Fly   106 HENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKT--FQGTSDGYLYGWGRDNS 168
            |..|.......|:.|:.|:....|         |:.||||.||:|.  |...|..::.|||..: 
  Rat   287 HPLYSAQNHDYDVALLQLRTPINF---------SDTVSAVCLPAKEQHFPQGSQCWVSGWGHTD- 341

  Fly   169 GLLPLNLQKLDAI------IVDYNECKAALPSNNSLAETNVCT-HTPGKADGSCNGDSGGPLVSQ 226
               |.:....|.:      ::..:.|.::...:.:|....:|. :..|:|| :|.||||||||..
  Rat   342 ---PSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGALTHRMLCAGYLDGRAD-ACQGDSGGPLVCP 402

  Fly   227 SSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |.... .|:|:|||| ..|.....|.||..|:.||.||.:
  Rat   403 SGDTW-HLVGVVSWG-RGCAEPNRPGVYAKVAEFLDWIHD 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 74/269 (28%)
Tryp_SPc 30..267 CDD:238113 75/271 (28%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 9/39 (23%)
Tryp_SPc 208..441 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.