DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk8

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:251 Identity:76/251 - (30%)
Similarity:106/251 - (42%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAV-AGAHS--RTDQ 90
            :|:.|.|......|:..:| .......|.|.|:.:..::|||||  ..|..:| .|.||  ..||
Mouse    32 KILEGRECIPHSQPWQAAL-FQGERLICGGVLVGDRWVLTAAHC--KKQKYSVRLGDHSLQSRDQ 93

  Fly    91 ENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQGT 155
            ...:|:...:.|:..:.|.......:||.||.|:.      :|...|...||...:|..|..|..
Mouse    94 PEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQN------SANLGDKVKPVQLANLCPKVGQKC 152

  Fly   156 SDGYLYGWG-----RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGKADGSC 215
               .:.|||     ::|   .|..|...:..|...|:|:.|.|  ..:.|..||..:...|| :|
Mouse   153 ---IISGWGTVTSPQEN---FPNTLNCAEVKIYSQNKCERAYP--GKITEGMVCAGSSNGAD-TC 208

  Fly   216 NGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWID---ENR 268
            .||||||||....     |.||.|||..||.....|.|||.:..:..||.   :||
Mouse   209 QGDSGGPLVCDGM-----LQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 72/242 (30%)
Tryp_SPc 30..267 CDD:238113 74/247 (30%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.