DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and KLK5

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:259 Identity:72/259 - (27%)
Similarity:102/259 - (39%) Gaps:50/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL---------------TYNQG 78
            |||||.:......|:..:|....|..:|...|:....::|||||.               .|..|
Human    66 RIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESG 130

  Fly    79 QAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVS 143
            |                :.|...:.:.|..|......||  |:|:|      ||...|. :..|.
Human   131 Q----------------QMFQGVKSIPHPGYSHPGHSND--LMLIK------LNRRIRP-TKDVR 170

  Fly   144 AVSLPSKTFQGTSDGYLYGWGRDNSGLL--PLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTH 206
            .:::.|......:...:.|||...|..:  |..||.|:..::....|:.|.|  ..:.:|..|..
Human   171 PINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYP--RQIDDTMFCAG 233

  Fly   207 TPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDENRKA 270
            .....| ||.||||||:|...|     |.|:||||..||.....|.|||::..|..||.|..:|
Human   234 DKAGRD-SCQGDSGGPVVCNGS-----LQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 68/251 (27%)
Tryp_SPc 30..267 CDD:238113 69/253 (27%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 1/1 (100%)
Tryp_SPc 66..285 CDD:214473 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.