DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk1c2

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:284 Identity:77/284 - (27%)
Similarity:123/284 - (43%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAH 71
            |.:|.| ||..|....||  :.||:.||:..|...|:.|::   .|.:.|.|.|:|...::||||
  Rat     5 ILSLVL-SVGRIDAAPPG--QSRIVGGYKCEKNSQPWQVAV---INEYLCGGVLIDPSWVITAAH 63

  Fly    72 CLTYNQGQAVAGAHSRTDQENVQIRK-----FTNAQYV-----------IHENYGGGVGPNDIGL 120
            |.: |..|.:.|.::....|....|:     |.:..|:           :|::      .||:.|
  Rat    64 CYS-NNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDH------SNDLML 121

  Fly   121 ILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSG--LLPLNLQKLDAIIV 183
            :.|.|         ..|.:..|..:.||:|..:..|.....|||..|..  ::..:||.::..::
  Rat   122 LHLSE---------PADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLL 177

  Fly   184 DYNECKAALPSNNSLAETNVCTHTPGKADG---SCNGDSGGPLVSQSSSRGAELIGIVSWGYTPC 245
            ...:|......|  :.:..:|.   |:.:|   :|.|||||||:..     ..|.||.|.|.|||
  Rat   178 SNEKCIETYKDN--VTDVMLCA---GEMEGGKDTCAGDSGGPLICD-----GVLQGITSGGATPC 232

  Fly   246 LSTTYPSVYTSVSSFLPWIDENRK 269
            .....|::|..:..|..||.:..|
  Rat   233 AKPKTPAIYAKLIKFTSWIKKVMK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 66/255 (26%)
Tryp_SPc 30..267 CDD:238113 67/257 (26%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.