DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk1

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036725.1 Gene:Klk1 / 24523 RGDID:2969 Length:261 Species:Rattus norvegicus


Alignment Length:281 Identity:80/281 - (28%)
Similarity:125/281 - (44%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVT 68
            |.::| |.| |:..|....||  :.|:|.||:..|...|:.|:|.:.: .:.|.|.|:|...::|
  Rat     3 FLILF-LDL-SLGQIDAAPPG--QSRVIGGYKCEKNSQPWQVALYSFT-KYLCGGVLIDPSWVIT 62

  Fly    69 AAHCLTYNQGQAVAGAHSRTD-----QENVQIRKFTNAQYV-----IHENYGGGVGPNDIGLILL 123
            |||| :.|..|...|.::..:     |..:..:.|.:..|.     .|....|....||:.|:.|
  Rat    63 AAHC-SSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHL 126

  Fly   124 KEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGL--LPLNLQKLDAIIVDYN 186
            .:.      |...||   |..:.||::..:..|.....|||.....:  .|.:||.::..::...
  Rat   127 SQP------ADITDG---VKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNE 182

  Fly   187 ECKAALPSNNSLAETNVCTHTPGKADG---SCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLST 248
            :|..|.  ...:.:..:|.   |:.:|   :|.|||||||:..     ..|.||.|||..||..|
  Rat   183 KCIKAY--KEKVTDLMLCA---GELEGGKDTCTGDSGGPLLCD-----GVLQGITSWGSVPCAKT 237

  Fly   249 TYPSVYTSVSSFLPWIDENRK 269
            ..|::||.:..|..||.|..|
  Rat   238 NMPAIYTKLIKFTSWIKEVMK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 68/249 (27%)
Tryp_SPc 30..267 CDD:238113 69/251 (27%)
Klk1NP_036725.1 Tryp_SPc 24..253 CDD:214473 68/249 (27%)
Tryp_SPc 25..256 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.