DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Ctrb1

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:273 Identity:95/273 - (34%)
Similarity:128/273 - (46%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVT 68
            ||::.|.....|..|.....|.  .||:||.:|..|..|:.||||..:..|||.|||:.|..:||
  Rat    10 FALVGATFGCGVPTIQPVLTGL--SRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVT 72

  Fly    69 AAHCLTYNQGQAVAGAHSR-TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLN 132
            ||||........|||...: :|:||:|:.|.  ||...:..:......|||.|:.|.....|   
  Rat    73 AAHCGVKTSDVVVAGEFDQGSDEENIQVLKI--AQVFKNPKFNMFTVRNDITLLKLATPAQF--- 132

  Fly   133 AVARDGSNPVSAVSLPSKTFQGTSDGY-------LYGWGRDNSGLL--PLNLQKLDAIIVDYNEC 188
                  |..||||.||:     ..|.:       ..|||:.....|  |..||:....||...:|
  Rat   133 ------SETVSAVCLPN-----VDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADC 186

  Fly   189 KAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSV 253
            |.:..|  .:.:...|....|.:  ||.||||||||.|...... |.||||||...| ||:.|:|
  Rat   187 KKSWGS--KITDVMTCAGASGVS--SCMGDSGGPLVCQKDGVWT-LAGIVSWGSGVC-STSTPAV 245

  Fly   254 YTSVSSFLPWIDE 266
            |:.|::.:||:.:
  Rat   246 YSRVTALMPWVQQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 88/244 (36%)
Tryp_SPc 30..267 CDD:238113 88/247 (36%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 88/244 (36%)
Tryp_SPc 34..259 CDD:238113 88/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.